PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29660.m000765
Common NameRCOM_0577360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 549aa    MW: 61477.5 Da    PI: 4.6443
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29660.m000765genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like67.52.2e-21207259255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     r+ WtpeLH +F  a++ L G +kA Pk ile+m+v+ Lt  +v+SHLQkY++
  29660.m000765 207 SRVLWTPELHLKFTAAISAL-GDKKARPKPILEMMNVPHLTQRQVASHLQKYKS 259
                    699*****************.9******************************86 PP

2Response_reg27.12e-1057140108
                    HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS
   Response_reg  40 kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108
                    ++ ++ l +   +mp+md lell  +  ++  +p+i+++++ +   a +a+  Ga+ +l +p+++++l+
  29660.m000765   5 QKGRFKLAMANANMPDMDSLELLHALLDKD--IPVILISSETSVFAARKAIAEGASFILHEPISIDDLR 71 
                    56668899999***************9877..**********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011019.974178IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.42E-9577No hitNo description
PfamPF000729.6E-6671IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23005.9E-13697No hitNo description
SuperFamilySSF521724.84E-13686IPR011006CheY-like superfamily
PROSITE profilePS5129410.536203262IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-23204263IPR009057Homeodomain-like
SuperFamilySSF466891.61E-15205263IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-18207259IPR006447Myb domain, plants
PfamPF002492.7E-6210258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MVQEQKGRFK LAMANANMPD MDSLELLHAL LDKDIPVILI SSETSVFAAR KAIAEGASFI  60
LHEPISIDDL RYVWQHAYRN RRNAADQTQN ETCQEKENGS NISQYPVIQE TTENACKEDE  120
VEGNAKETYA LIEKDCSKTL ENTITEHSMT DSNEKQGVEK IKRRNEVRHE EQREKRVKII  180
FEEENHKWKK TIIEEEIEEK SSSDRRSRVL WTPELHLKFT AAISALGDKK ARPKPILEMM  240
NVPHLTQRQV ASHLQKYKSQ VRRICETGTT SLPAVCRSSN FAGRTRVLDA ADKNTSAAVC  300
EQGSQSSDFG IRDILRMSES FYRFRTPNII SSNSSQSKSQ VPVTSSSTTI QELLDCLAGK  360
GTSGNVPTPC AAKLPTNFIN EENPKLDIME ASVPISGNES CADKFRKDLI DVDRGTDSME  420
ISNTNSVNVP DTYMSTAGFA NEELDALTYL SLNDQGLPNL DKDLTGFGDL NQELDPMEVL  480
SPTSRNVSND TAVSALPANQ SQIQSKYADI WNMLEEEPDG SFNDLEGEAN PEDIDRYCQW  540
LTNVMLGNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-14202264163ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9SJX50.0B9SJX5_RICCO; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144041618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.12e-30pseudo-response regulator 6